DPCstruct | MC62182
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 79 ± 6 aa |
| Standard deviation of domain lengths | 5.58 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 74.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 46.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J6MI77 | 1-80 | MDVVPGLLNYYLLDVYNLVTDRLVMEHGVIEITKELVHKMTGLPMEWEDLNRMSYCETGNEILEEWKAQFVDKKFHGKQM |
| A0A6S7M970 | 19-98 | MGFGAFLDINLDSIPSRLAYYLVDKFKAKTSTIKTKKGEILITKKTLKGMFGLPSEGLDYNQLVECDKTNTVIEAWKSQY |
| A0A2U1MJB8 | 302-379 | None |
| A0A6S7NRI2 | 28-92 | None |
| A0A6S7MY54 | 1-80 | None |
| A0A6S7PKT4 | 151-226 | None |
| A0A6S7NX04 | 232-316 | None |
| A0A6S7NT18 | 25-103 | None |
| A0A6S7Q4U0 | 59-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.