DPCstruct | MC62181
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 66 ± 10 aa |
| Standard deviation of domain lengths | 10.21 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 59.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J6MI37 | 11-70 | MPKVPVDESIRGTKWPKTWPQRLESPPYWLKAIESGVYGKSAPEDFTADYEHWKRVVSKS |
| A0A3L6RY16 | 20-79 | THRVPTGPSERGARWPVDWPRRVRTPPYWLSAARAGVYGKPEPEDFTVDYDHWRRVVDRS |
| A0A835HD18 | 122-179 | None |
| A0A2J6K5Q3 | 187-261 | None |
| A0A6J5VLX5 | 1-56 | None |
| A0A835HI73 | 89-159 | None |
| A0A835H158 | 134-226 | None |
| A0A6A2ZZJ1 | 88-160 | None |
| A0A103Y5H7 | 1-59 | None |
| A0A6J5Y0F5 | 1-57 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.