DPCstruct | MC62180
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 301 ± 77 aa |
| Standard deviation of domain lengths | 77.33 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 70.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 26.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11145 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J6MG03 | 2-416 | IGCLGIVDKDGIGIGCDSRICLYIPLSFSIKQRSIILGTISSLKEGNSSFFPLTFEKLVRPSELYDQYTESHPYYTYSKIDLAGTIL… |
| Q5QM74 | 319-672 | LVADGFWKPSQGRLCLRACRTVRSTVRESDCGIRIHFWFPAVWSIQQRSFVAGMIRNTRSDDDGDTNKMSGAISVSRTGFRGDLSDI… |
| A0A6A3ANZ5 | 33-443 | None |
| A0A446N8I0 | 300-637 | None |
| A0A834TIH2 | 329-709 | None |
| A0A445HTU3 | 18-354 | None |
| A0A1E5UYE4 | 509-931 | None |
| A0A6J5X7M5 | 1-207 | None |
| A0A5N5FRB0 | 5-182 | None |
| A0A3L6QE76 | 396-714 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.