DPCstruct | MC6218
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 120 ± 7 aa |
| Standard deviation of domain lengths | 7.25 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 49.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G4G5Q8 | 15-144 | NIGIRHSDMARRVCAAVEHFITSALYASSNREVVGGTANVGGVTVRVPLQCFAIMADSRPHQVVHTRGRVGVREVVQRARLDEAARH… |
| A0A0G4EAP6 | 1011-1128 | LRHTDMADRVHAAAEHFVRSALRANSNQEVVGVVANVGGRTVRVPLQCFAVRRQHDGQHRLLGLREVVHRARLDEADRHGVTGVEKD… |
| A0A0G4EGW4 | 16-136 | None |
| A0A7S1JZG6 | 2-99 | None |
| A0A0G4EXC4 | 723-850 | None |
| A0A0G4EVH2 | 543-661 | None |
| A0A0G4ESS9 | 226-346 | None |
| A0A0G4ERS0 | 338-452 | None |
| A0A0G4EQ64 | 401-522 | None |
| A0A0G4EKL2 | 69-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.