DPCstruct | MC62168
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 182 ± 21 aa |
| Standard deviation of domain lengths | 20.89 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 21.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A512UDX0 | 16-170 | EQFQAKMEAFRTCLKAFIHDTVFEEAEFRLSWKILAQKLAHLREQSQWASPWGFDVLAQLEYAETMLRTMLDSAFFMDYFTPDGGMA… |
| A0A512UB29 | 23-200 | VHVSARGYDAITDKLEVVEERLQTFIARLKSYILEPLFDIERFELEFTTLDKELADITRAAEKADPNKERSEKLTFAQSLFEIMIES… |
| A0A4P6XU53 | 74-268 | None |
| A0A4P6XS15 | 30-205 | None |
| A0A4P6XNR5 | 37-245 | None |
| A0A4P6XMR7 | 108-301 | None |
| A0A512UNX3 | 52-246 | None |
| A0A512UMX7 | 1-150 | None |
| A0A512UJF1 | 43-244 | None |
| A0A512UHM4 | 13-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.