DPCstruct | MC62157
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 193 ± 31 aa |
| Standard deviation of domain lengths | 30.84 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 74.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 35.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H5RIH2 | 240-387 | GERFKIDYNNANQTKDEKDLNDYRNWNIIEFLKPISIFELVDDDLRKELYSFFGKRILYSKVKTKLFDIENVKDDKIKIIELPQKIS… |
| A0A2Z6QGW7 | 246-421 | KNIKISTKIHDSKRKPKFHSYNYIISDSEFFDENAWIESLTDYQKWNCTEFKNPISIFQLLPDDLYKEVYKLIGKRILYTCVENYDY… |
| U9UQ41 | 28-257 | None |
| A0A2N1NUH9 | 121-327 | None |
| U9UCB6 | 78-311 | None |
| A0A2Z6QI72 | 243-402 | None |
| A0A2H5SU86 | 249-444 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.