DPCstruct | MC62156
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 330 ± 50 aa |
| Standard deviation of domain lengths | 50.25 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 27.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U9UPU2 | 2-340 | CNKCLEFMDKKENRNFQVAYRIELLPNNNQKEWEYAIQLDPVIWFDMLYNLSGDLPNTLKAARSYVNSVRRKYKLPAPIEPTMNSIP… |
| A0A397J0Q0 | 25-378 | EKPVVYVGTVDFQEDLNKVAMRLSDMGEQCLKFINDNPNFQAKYRIEIRPDEDEWKLYLHLDPVAWFDALYPSEEETLLVKARKYVD… |
| A0A2Z6RN53 | 174-560 | None |
| A0A2Z6RL25 | 126-387 | None |
| A0A819Q462 | 55-429 | None |
| A0A2Z6R321 | 15-257 | None |
| A0A2Z6QJG7 | 1-282 | None |
| A0A815NAQ1 | 34-298 | None |
| A0A2P4PH05 | 11-370 | None |
| A0A372RI67 | 56-360 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.