DPCstruct | MC62152
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 283 ± 46 aa |
| Standard deviation of domain lengths | 45.93 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 70.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 21.24 |
| Pfam Score | 90.48 |
| Assigned Pfam label(s) | CL0123- PF08624 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U9U985 | 1-296 | MEADEAEGGNNNDEDDGKLDEKGEQKITKDGELLGGRKFKVQVFQLPSRGNIWYMLSMDPAKLLGFRDSYLFFLRNPTLKRIHATDQ… |
| R4XCY1 | 217-436 | VRTPVEAVVPNLVQSNDDDDDEGKTKVDEHGALKGDRTYTSKAFRLPMRGDTYYFLATEIARVSGYRDSYLLFNKNRNLKKLMTTEA… |
| A0A5J5EZ55 | 1-282 | None |
| A0A177B8D8 | 38-313 | None |
| B6K5G9 | 52-364 | None |
| Q6FLW5 | 69-392 | None |
| A0A2B4S543 | 47-323 | None |
| A0A066W213 | 475-769 | None |
| T1FZ52 | 2-274 | None |
| A7A1Z0 | 67-412 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.