DPCstruct | MC62151
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 212 ± 36 aa |
| Standard deviation of domain lengths | 36.35 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 40.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U9U8C9 | 2-183 | ELFHFLSAGPLVINYAPQKLFQNINYIEDLILNKKFIPFPPRPKLAYEDTIEEYPPKDGYENNRQLNVIARAIIIHPDLVNMWKSIG… |
| A0A397JKA1 | 96-352 | KYDPNLIKLKIEHNENNSDTNRLNELNKKFCKSWASNLSIDVFVTIITEGFSRFNDDVPVKGNDMELFHFLSAGPLAISQAEIKLKS… |
| U9TNP7 | 78-346 | None |
| A0A2N0S4P0 | 51-242 | None |
| A0A2I1GU06 | 154-312 | None |
| A0A2P4QZU0 | 5-160 | None |
| A0A2Z6RIF3 | 6-214 | None |
| A0A397SPM0 | 16-238 | None |
| A0A397UDM6 | 3-196 | None |
| A0A2Z6QG81 | 73-336 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.