DPCstruct | MC6215
Metacluster Properties and Pfam Annotations
| Number of structural domains | 281 |
|---|---|
| Mean domain length (aa) | 218 ± 43 aa |
| Standard deviation of domain lengths | 43.12 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 14.07 |
| Pfam Score | 46.36 |
| Assigned Pfam label(s) | PF11597- PF16486- PF08699- CL0010- PF15813 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R7TGW3 | 1-182 | MFLNRFALRPLNPEELRPWRLEVVLDPPPGREEVYPLLAQVARRAGGVTVRMGDGLASWSPPEVLVLEGTLARMGQNYAYRLYPKGR… |
| A0A0G4FZI9 | 12-230 | VPIDRPGHYTKGRQIQAIASVLPIRVKFKPGTNLHIYSISFSPQLPGDFRRQNRIVADMKAKLSQELNMQGECLFTGTALLTIRHTD… |
| A0A7T5ETB5 | 194-358 | None |
| A0A813W958 | 36-236 | None |
| A0A1Z3HTT2 | 20-315 | None |
| A0A0F2NL31 | 325-567 | None |
| A0A0N5CTI6 | 20-262 | None |
| A0A0D8XSL2 | 4-257 | None |
| A0A7R9PUW0 | 382-619 | None |
| A0A6I9Z0I4 | 1-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.