DPCstruct | MC62148
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 294 ± 53 aa |
| Standard deviation of domain lengths | 53.15 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 68.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 21.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G3ZG16 | 6-242 | RNWGSGSKRTLVQRYTDELSQITGEIHELDRSLKTSQQAMDNMQSVLTYNGSGLVISVFAYLYWKWDGNWFRIAAGVAACIALLAVV… |
| U9U5N7 | 5-263 | DNYEKILSELDDDIGRAEVRLREIRIRERSALIIWIVYSMLAYVAYVAGYWYFVYMSIEEEGWDFMKIAPVFTGPFFIVIGYRFLAL… |
| B8MP71 | 16-314 | None |
| A0A3Q7S4X5 | 2-202 | None |
| I1CSP7 | 2-232 | None |
| S2K1P2 | 6-316 | None |
| A0A815GZH8 | 124-442 | None |
| A0A545UMZ0 | 310-650 | None |
| C1GSU2 | 13-404 | None |
| A0A834Z9T1 | 288-529 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.