DPCstruct | MC62142
Metacluster Properties and Pfam Annotations
| Number of structural domains | 92 |
|---|---|
| Mean domain length (aa) | 134 ± 24 aa |
| Standard deviation of domain lengths | 23.80 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02042 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J6K7Z0 | 24-153 | MEKERAENGNVGTSRYTSKMMLCRETIAKYFYITIKQEAKEVNVGITLLKKFCRDLGIHRWPHRKLMSLETLINNVQQEFSKEFGGK… |
| A0A836C437 | 650-773 | PSGAGGGGGGGQDSLAALREVFDLPVSDAVRVLGCSASELKRRCRALGIKRWPQRKLLSLRRIAEAADADSSLTPEERQAVQERVSS… |
| A0A7S1T3W8 | 137-250 | None |
| A0A3F2RQU3 | 10-164 | None |
| A0A292G2R1 | 355-480 | None |
| A0A835IZ85 | 142-277 | None |
| A0A830CEK7 | 7-120 | None |
| A0A2C9W4Q1 | 166-280 | None |
| C1N4X2 | 1-161 | None |
| C1EJ86 | 57-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.