DPCstruct | MC62141
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 82 ± 12 aa |
| Standard deviation of domain lengths | 12.06 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 60.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0165 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J0LH24 | 176-259 | QGTFADYTARTAFERPLLSGVAYAEKVVNAEREMFESQHNWVIKTMDTGEPSPVRDEYAPVIFSQDSVSYLESLDMMSGEEDRE |
| A0A453H871 | 2-78 | YTARTSFERPLLSGVAYAQRVMHADREAFERQQGWIIKTMKHEPSPPQDEYAPVIYSQETVSYIEGLDMMSGEEDRE |
| A0A6A4P4L2 | 252-344 | None |
| A0A3L6QKI2 | 164-256 | None |
| A0A0E0ALT7 | 34-97 | None |
| A0A059AC47 | 71-143 | None |
| A0A803Q3H9 | 113-195 | None |
| A0A2P2LHE0 | 161-259 | None |
| A0A453H7V6 | 2-72 | None |
| A0A6V7QUS4 | 127-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.