DPCstruct | MC6214
Metacluster Properties and Pfam Annotations
| Number of structural domains | 82 |
|---|---|
| Mean domain length (aa) | 294 ± 52 aa |
| Standard deviation of domain lengths | 52.00 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 21.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G4FU67 | 26-279 | AGEDDAGWLSNSADMLEQGTYEWSVIASFIRMANIYRITPPQQKRLIVSSCPAPSTNRLPLAMAAYSIIGDQLTHRGRSMALQRSDG… |
| A0A0G4FQC7 | 100-375 | LFDLPPEIDALLVAKGLKDILSYDLPSVGHLLRLLDIIQQSDEWAATVAIVRVAKHQGWRGGQLPIELGSADVEGVGSRAVFEGRCE… |
| A0A0G4ES90 | 167-527 | None |
| A0A0G4EI76 | 5-281 | None |
| A0A0G4EQB7 | 83-364 | None |
| A0A0G4ENJ9 | 27-332 | None |
| A0A0G4ENJ2 | 12-254 | None |
| A0A0G4EMP0 | 32-363 | None |
| A0A0G4EIX2 | 8-219 | None |
| A0A0G4EHF7 | 21-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.