DPCstruct | MC62137
Metacluster Properties and Pfam Annotations
| Number of structural domains | 98 |
|---|---|
| Mean domain length (aa) | 124 ± 19 aa |
| Standard deviation of domain lengths | 19.05 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02401 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J6JKJ7 | 235-358 | ETIATASFAGKYVIVKNMDEVRQDAMYKLVDEKLDVMLVVGGWNSSNTSHLQEIAEDRGIPSYWVDSEQRVGPGNHITYKLMHGECV… |
| A0A3L8I1Q9 | 14-145 | EKKGAIFVDETAEVPEGNIVIFSAHGVAPVVHDEAARGKLATIDATCPLVTKVHKEAVRFAKDDYDILLIGHEGHEEVIGTSGEAPE… |
| A0A7Y2NDU1 | 2-90 | None |
| A0A7W1EP73 | 4-122 | None |
| A0A7V2XK24 | 246-362 | None |
| A0A377M6B6 | 1-162 | None |
| A0A7X8I5Q9 | 165-280 | None |
| R6H902 | 7-116 | None |
| A0A3D4H4G6 | 345-481 | None |
| A0A1Z2LDY2 | 4-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.