DPCstruct | MC62130
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 72 ± 13 aa |
| Standard deviation of domain lengths | 12.83 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 47.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0337 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X8MAE5 | 1-42 | IRSYVFHPYNLVKDHRTEHETSNISTVMDGDLDDFIHAYLMQ |
| A0A7C0YPP4 | 2-65 | EEKQTKELGKLKTKVKPEWGSQIRSYILNPYKLIKDHRTGIETTQVEKVLEGNLDLFVEGDIID |
| F1W3N9 | 92-164 | None |
| A0A199XTD2 | 166-253 | None |
| A0A1W9SM69 | 252-325 | None |
| A0A7C5C954 | 41-103 | None |
| A0A507EC17 | 907-988 | None |
| A0A7R9NDW9 | 1-52 | None |
| A0A7W7J525 | 188-248 | None |
| A0A831W529 | 2-62 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.