DPCstruct | MC6213
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 156 ± 27 aa |
| Standard deviation of domain lengths | 27.49 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09717 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A8W262 | 18-148 | IICERDYNLPCPDDYNYIGDIHEPDDEICAPSSTYDGPCIGEELNVKHMSAKTKESWSKKCQAFWPCRKCVRNFTSFCPEKWNKIEG… |
| A0A0G4FRU3 | 25-189 | SSAQQTDMLMKAISEEVPPANVAIADRITSGVATPFDPVRHSPCPLLFDDISPPASADYHLCQASTEYDGPCSDTAANFSAHMSQAA… |
| A0A7S1F569 | 100-278 | None |
| S6BF07 | 4-129 | None |
| A7ATX2 | 491-612 | None |
| A7AM11 | 18-158 | None |
| A0A1N6LXS0 | 41-241 | None |
| A0A1N6LYG1 | 94-286 | None |
| U6MN65 | 259-408 | None |
| A0A653H5I7 | 82-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.