DPCstruct | MC62126
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 210 ± 34 aa |
| Standard deviation of domain lengths | 34.02 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A103B0U4 | 5-177 | FMSGFAFFIMAFGDLNRYMLRSLSARDIYQERVNAHIYEDDHHWPWFLKYFERLGWSRITNSTDALRARWSEDTHHNRLLMYELCVN… |
| A0A3S1FGX2 | 1-233 | MKEVFKFIEVKKQEFAKLPFCEFLQDKSIDPRQRLAWAPCLAPFVMNIWEVNKYFLREEPTSDPIQKIINKHTYEDDHHYVWYLEDM… |
| A0A6M0EY25 | 1-236 | None |
| A0A085WMI5 | 1-212 | None |
| A0A1X7D6Y6 | 1-233 | None |
| A0A6P8IU15 | 56-293 | None |
| A0A2L0F3T2 | 1-176 | None |
| A0A3M2I4G9 | 1-229 | None |
| A0A6B3BGX4 | 1-230 | None |
| A0A817PAE5 | 19-299 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.