DPCstruct | MC6212
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 170 ± 36 aa |
| Standard deviation of domain lengths | 35.52 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 82.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.38 |
| Pfam Score | 98.94 |
| Assigned Pfam label(s) | CL0063- PF06644 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G4FR31 | 14-183 | YLWLEQFKDKPRVLTDVLQPDEYDTLTKNASHAPMFIAPLTKSPHHDMKGNGIEAAKVQLQGTQGFRTLVLQFQDKKHILYTSLEEF… |
| A0A7N2R3J9 | 1-130 | MKAKLYYLLEQRAADCRYFVIPLWRGSGYTTMFAQVQMPHVLFTGLEDYKARGTQSAPYFTVSYYNEFAESKDLVLIRGDVVFTSKI… |
| L8YC84 | 138-280 | None |
| A0A842ZCB5 | 1-102 | None |
| A0A0G4NIB9 | 474-673 | None |
| A0A3L8E1H4 | 101-280 | None |
| K0RD43 | 107-292 | None |
| A0A2V0PIZ3 | 66-220 | None |
| A0A7J8F6A8 | 7-163 | None |
| A0A7D8V2N0 | 87-320 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.