DPCstruct | MC62111
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 220 ± 47 aa |
| Standard deviation of domain lengths | 46.72 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 87.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 28.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A031I5S7 | 115-305 | TSLSEADAADVVWFVRQYRGDVFRLLPEAIALRKNRALVGGALLLHVDRCAQRDTFLQRHIETATDVLRLAAALSGGDISLATASER… |
| W8YDA1 | 123-315 | GSEEDFNQMISQLISANSSISSTDKTDVEWAITHTEDVSCFLPNVIPHKENMSFIIGVLLINRKISADAAAKYFKTATDVLRLAVAL… |
| A0A2H3KG33 | 1-174 | None |
| H8H253 | 226-520 | None |
| A0A5C5XM72 | 149-336 | None |
| A0A7T4U0C4 | 1-241 | None |
| A0A496M2B2 | 174-479 | None |
| A0A1Y2ATR8 | 570-779 | None |
| A0A1I3XAW7 | 59-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.