DPCstruct | MC62106
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 222 ± 42 aa |
| Standard deviation of domain lengths | 41.51 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11013 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V4RI95 | 1-224 | MKSHRQVAERFLLHIWDGQHLKKEMRTTDGETVRVECAGTWNFDSGPDFKNALIHIGGRTVTGDVEIHIKPRDWTAHGHHRDPRYNG… |
| A0A1Z5HGS3 | 1-157 | MKEDFLHHIWQYKKFDFTNLKTTSGENVSIFNTGNFTQLAGPDFFNAQIEIDNQKWAGNIEIHLKSSDWYIHNHERNEHYDSVILHV… |
| A0A7C2C418 | 39-202 | None |
| A0A6H9L792 | 3-235 | None |
| A0A419FJF8 | 130-401 | None |
| A0A7C4AVU4 | 19-292 | None |
| A0A1V6E3Y5 | 21-164 | None |
| A0A136LEE1 | 9-245 | None |
| A0A357TF20 | 2-240 | None |
| A0A1Y1RKR6 | 3-295 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.