DPCstruct | MC6210
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 312 ± 38 aa |
| Standard deviation of domain lengths | 37.96 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 69.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.03 |
| Pfam Score | 78.37 |
| Assigned Pfam label(s) | PF02671- PF08295 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9Q1V0 | 2-281 | FFEKVKKALRSSEAYDNFLRCLHIFNQEVISRAELVQLVIPFLGKFPELFTWFKNFLGYRESFHGESSHTESLPKERATEGIAMEID… |
| A0A0G4F9L4 | 11-318 | AGASSSSDGRGEEAALLVRRIKALDPKSYEQLRTALENYVGGGEPWDETWRTVIQIMEGHPSLWKNSFIFMSDVADRIRALSADMER… |
| A0A6S8VHN3 | 70-414 | None |
| A0A0C2MR01 | 89-399 | None |
| A0A0K0EKT0 | 907-1233 | None |
| Q6FNH7 | 149-472 | None |
| A0A7N2MEA7 | 11-326 | None |
| A0A7N0REP5 | 315-659 | None |
| F0YHI8 | 4-261 | None |
| A0A7N2KZ66 | 87-453 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.