DPCstruct | MC621
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 277 ± 46 aa |
| Standard deviation of domain lengths | 46.30 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 73.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9BEZ2 | 204-559 | ALFGFQLALTMIMASFLQKLGVYYSFGRWLLCSTGLTRFLYPTDVELKTLMKAQTHEKSRRRHKEKEGEVKSSFMVPRNLDIPLETA… |
| A0A158QK35 | 1-233 | MAILGFHIVVSLVALTIMSKLGSRLSIVELYIVKGLFRFIAPSNDEIRALMPPSKENPRVRRKKREEENSDGFNVPKSLPLRLKVGR… |
| A0A397D1M1 | 534-944 | None |
| A0A1I8H5N7 | 3-242 | None |
| A0A0P6JCV4 | 1-221 | None |
| A0A812C2Y9 | 146-408 | None |
| A0A8B6H2Q1 | 512-783 | None |
| A0A564YT27 | 1-302 | None |
| A0A226N296 | 33-317 | None |
| A0A3Q2TWL9 | 1-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.