DPCstruct | MC62098
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 82 ± 9 aa |
| Standard deviation of domain lengths | 9.43 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 52.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03676 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P8BPS7 | 16-91 | RSLTFGDSVQDVLSALGSPSRVFYKTEDKMKIHLPQSHRLVQPRKSDYFFNYFPLGLDILFDAQTHEVMKFVLHTN |
| E2REW8 | 346-424 | GDSCQDVLSVLGSPHKVFYKSEDKMKIHSPSPHKQVPSKCNDYFFNYFTLGVDILFDANTHKVKKFVLHTNYPGHYNFN |
| A0A453SH78 | 103-178 | None |
| A0A1A9VYL3 | 252-325 | None |
| T1DC37 | 77-152 | None |
| A0A1Q9CLV3 | 352-436 | None |
| A0A3P8KET8 | 70-150 | None |
| A0A2A2K166 | 1093-1171 | None |
| A0A3P7EZI1 | 1-69 | None |
| A0A453SH66 | 17-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.