DPCstruct | MC62097
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 123 ± 19 aa |
| Standard deviation of domain lengths | 19.33 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 39.97 |
| Pfam Score | 93.81 |
| Assigned Pfam label(s) | PF08366- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P8B2G7 | 156-261 | ETMDPYAVAILLQEDLVVIDLLSTNFATFENPYPMDLHSSPVTSCLYLVDCPGDLIPAFYSVSSRRNRTQSGTCAEPDVFSSREWPI… |
| A0A6J1VYZ2 | 1-103 | MILSPTEFDDPSTMVVLAEEELVVIDLKSPGWPSIQPPYLASLHCSAITCSHHVSNIPLKLWERIITAGSKQNVQFSNMPWPINGGI… |
| A0A7R9CRX2 | 2-108 | None |
| A0A4Z2EPW1 | 189-310 | None |
| A0A183QPF5 | 136-239 | None |
| A0A2J7PPV2 | 106-246 | None |
| A0A2J7PPU8 | 106-246 | None |
| A0A4Z2BQZ2 | 3-126 | None |
| A0A5N3WKZ3 | 202-285 | None |
| A0A085LK69 | 1-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.