DPCstruct | MC62095
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 146 ± 13 aa |
| Standard deviation of domain lengths | 13.13 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0184 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7VL49 | 28-167 | HLLQAVGMEGIFGCILMSGIVLPAVHFIPGNDLNGSYENVIDAIYQIGNNYILLGNCIIYVFSIAIFNYCGLSIARSLSSIHRTLID… |
| A0A2I1DXE9 | 99-247 | AQIFTASQFVIEEKIMERYHVKPLRAVGLEGIFGLLTVGVGAIILHFTIGIHHPGGYFDISTGWNQILSFRQIWITGIAISFSIAFF… |
| A0A1V9YKJ4 | 588-734 | None |
| A0A7S2SX01 | 8-161 | None |
| A0A7S2VQF7 | 24-177 | None |
| A0A7S1R2N3 | 11-162 | None |
| A0A183QCN0 | 46-184 | None |
| A0A180GF48 | 91-232 | None |
| A0A058Z5J5 | 89-215 | None |
| A0A482UGP3 | 13-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.