DPCstruct | MC62092
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 192 ± 25 aa |
| Standard deviation of domain lengths | 24.87 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183N3Z0 | 1-168 | MDDLPLPEQDNEELWTMVYRGPQPKFVKGHRVNTIIINHVDHYHFVFQSSIKNRFRTIRNILNAGNITSDVGGTLQPIRNWHAFMTY… |
| A0A0R3SM33 | 49-223 | SRYYTFAIRGQRAYPSHISCVYVEHEDHLHILIKCNGNVGGKIDRVLRDCNVPPGDWYQAKLTKILVNNPVKIIRYFKFHNEPIIIG… |
| A0A564YB67 | 1-191 | None |
| A0A0R3TEN8 | 24-240 | None |
| A0A2J7RSB0 | 276-482 | None |
| A0A7E4T4U3 | 1-166 | None |
| A0A1S8WIB3 | 193-363 | None |
| A0A2J7RSA2 | 153-390 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.