DPCstruct | MC62085
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 205 ± 33 aa |
| Standard deviation of domain lengths | 33.41 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 70.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 28.46 |
| Pfam Score | 98.28 |
| Assigned Pfam label(s) | PF14388- CL0293 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S8KVF5 | 53-234 | LSTEPILPRSNGLVNTIVAAYNQHHALSLRPDDVWICILTQFNFFVNANAEALRSIFVSHEGKKELTVATVGSRYTVDFGYLARLMT… |
| A0A0A2JEE7 | 1-200 | MPITLTTAKHPPRGWKLQRVAEVEELFEQSCPKEHDGSKRLVGSSFTKDLFDTSYISASENGFVWAVFHAYSQHHNLVLRPEDVWFT… |
| A0A166E303 | 3-197 | None |
| A0A3N1KJ94 | 195-429 | None |
| A0A1L7VSN7 | 61-246 | None |
| A0A819QGY0 | 3-197 | None |
| A0A6A5V7M8 | 2-141 | None |
| A0A7M5X8P3 | 41-270 | None |
| A0A1I8IVA0 | 85-298 | None |
| G0RV55 | 58-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.