DPCstruct | MC62075
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 197 ± 34 aa |
| Standard deviation of domain lengths | 33.56 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 70.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 40.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0CDB6 | 1-207 | DNVYSSQHPPQEFISSSLHRQSYSSQHTYNQQPQQQHREHHVNQDHRDYSSHPRELQNASSLPLQSNLPPPLPVNDVQQIPAKLPDR… |
| A0A448ZEL4 | 595-787 | PPEYSYPPPPPHYGGPEDHDLPFYGGTAPPLHPSYHHRGGPPLPMPGPHHPGMPIPPPHMMGGPPPPYHYGHPPRMEEKTILRKKFS… |
| B8C7F1 | 167-425 | None |
| A0A7S2I9M4 | 147-382 | None |
| B8BX73 | 542-738 | None |
| A0A7S0UH29 | 62-289 | None |
| A0A7S1YJF8 | 36-217 | None |
| A0A1E7FYU9 | 380-562 | None |
| A0A7S4AUS8 | 1-139 | None |
| A0A7S4MRB5 | 1-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.