DPCstruct | MC62070
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 304 ± 23 aa |
| Standard deviation of domain lengths | 23.12 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 72.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.31 |
| Pfam Score | 89.77 |
| Assigned Pfam label(s) | CL0105- CL0091 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0CAQ6 | 53-404 | KPKQQSCALLCGEALSEQLPRHLHPPPTVLVDGFFKGPDRLKQALRHDAIIIIAGGIGITAYLTLLDGIKHSLKRQSTAEADDGTEA… |
| A0A3F2RGD3 | 725-1031 | DGYYGASLEMYDEYSTMCLVGGGIGVTPLFAILEDIVAKLQQGGSLRQKVFFIFTFRELSLLEEIHPLLMQLKELDPQEQYFSLHFS… |
| A0A2K1J857 | 439-755 | None |
| A0A7J9HI35 | 161-477 | None |
| A0A4S4EGQ6 | 293-583 | None |
| A0A3F2RW14 | 820-1128 | None |
| A0A7S1KFV7 | 1-318 | None |
| A0A5A7QN08 | 593-871 | None |
| A0A1P8BD89 | 239-549 | None |
| A9RKK9 | 365-666 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.