DPCstruct | MC62060
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 120 ± 4 aa |
| Standard deviation of domain lengths | 4.37 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 85.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 42.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6T8HNC9 | 21-141 | LPYRLGIVVSVGAGLGSFPMCFDIDIVHWFNTAYVTADIPEQKDLETWLEVGSWSWNWMEPPLGQVSFLLLCLTYARSQLQNLGKKP… |
| A0A7S2YS86 | 196-312 | GLPFQIGAASMIIGGLACLPLVFHLGTVEWFNQTYVTADVPPKKDLETWLEVGAWSWNWMEPLLGTGTFVLLCVQYFRINMDHLGIK… |
| A0A813DLB9 | 1-116 | None |
| A0A7S4A849 | 175-298 | None |
| A0A7S0MEQ4 | 60-180 | None |
| A0A6U4WUA3 | 156-279 | None |
| A0A7S0J9D2 | 43-170 | None |
| A0A2R5GWF8 | 116-238 | None |
| L1J266 | 83-198 | None |
| A0A7S4MF35 | 21-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.