DPCstruct | MC62057
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 102 ± 15 aa |
| Standard deviation of domain lengths | 14.61 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 75.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 38.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6T8FE97 | 2-122 | RKKEYRQLLASQTLQAKAEAIQEEFLDSNEDDLGLELVSGRNTQHWGRLVRAPLKKKKHVILDYCTSCSSSCGGNAKDGTGQEEGRI… |
| A0A7S3PWX6 | 575-675 | AIHLEAAVNVEDQFLDSNTDLLGLELVRGNSRSSWGRLMRAPIKKKGHVIVDYCAVTTDEDGKDVGRIVRSKVTKGRSARAAPGMYS… |
| A0A7S1H3L6 | 4-105 | None |
| A0A7S0PWV2 | 17-124 | None |
| A0A7S0L147 | 266-373 | None |
| K0R567 | 2-111 | None |
| A0A803LWP0 | 41-118 | None |
| A0A7N2MPE6 | 125-203 | None |
| W7U9Y7 | 476-582 | None |
| A0A7S2W366 | 57-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.