DPCstruct | MC62054
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 113 ± 16 aa |
| Standard deviation of domain lengths | 16.11 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 45.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0064 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C9IMM8 | 13-105 | DPKILKLLVLGVIALLFSGIGGILGGYVMYFIKKGNYNPVIGIAAVSCVPTTAKVAQKIVSKDNPNSFILGDALGANISGVITSAII… |
| X1EFU5 | 35-140 | VGASMAAEVFLTPQTLGIFFLGVFAFALATAAGVLTAKLMNLFVKEKINPMIGAAGVSAVPMSARVVQRMGQEANPRNFLLMHAMGP… |
| A0A8A6AMP5 | 108-211 | None |
| W4P855 | 1-86 | None |
| A0A7U7GCZ6 | 23-129 | None |
| A0A7X1GNE6 | 154-248 | None |
| A0A7Z9ZKP9 | 143-266 | None |
| A0A2S6B9Y3 | 1-96 | None |
| A0A416NH77 | 135-256 | None |
| A0A812KNM5 | 235-373 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.