DPCstruct | MC62053
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 225 ± 53 aa |
| Standard deviation of domain lengths | 53.12 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 75.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.66 |
| Pfam Score | 70.83 |
| Assigned Pfam label(s) | CL0182- CL0582- CL0064 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B6E4S0 | 87-329 | YKTYKYKVVIENIIRDNKLLTITPETTINTNDIVAITFYADLDIQSIISKDIEVTKPEQFNFIEEKRSLILTNKNLFNKTIKEVKDI… |
| A0A800E4Y3 | 1-198 | MIKDQQHLAEIVVTRGSLLHRTSLMGVRFAQRTGLLPLAIHRARAPGGEEISSHIGTERLRAGDVVLVQGADTELEKLKRSGTALVL… |
| A0A7R9UYM3 | 1-230 | None |
| A0A507DRF4 | 199-492 | None |
| D2W1W2 | 249-490 | None |
| A0A7Y2VCM3 | 10-233 | None |
| A0A485B808 | 129-267 | None |
| A0A7R9TJ04 | 630-809 | None |
| A0A7R9TQQ5 | 222-399 | None |
| A0A7S1W748 | 423-677 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.