DPCstruct | MC62051
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 123 ± 13 aa |
| Standard deviation of domain lengths | 12.68 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 19.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R9I313 | 36-143 | RIDSLRMVTPGIPVVVEKDTLFYLYAKRGGHTPQQRAKDVSNVIEALGTRFNLRPDSVYLESTDIVTDLMYGEKVIISFTDQDALWE… |
| A0A6C9G6G5 | 97-207 | RIDSLRQFTKGMPVVADGDTLFYLFTKRGGYTPQQRAQMTGAAIEEIGRRFNLKPDSVAIDHSDIVSDLMYGSKVLLSLTDQDALWE… |
| A0A1G1STA9 | 10-120 | None |
| R5C4A4 | 93-203 | None |
| A0A496MNJ1 | 82-191 | None |
| A0A7Y5Q377 | 327-440 | None |
| A0A7V4XGD1 | 16-124 | None |
| A0A7V1REB3 | 13-134 | None |
| A0A850AYR6 | 73-193 | None |
| A0A847ADZ6 | 1-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.