DPCstruct | MC6205
Metacluster Properties and Pfam Annotations
| Number of structural domains | 130 |
|---|---|
| Mean domain length (aa) | 57 ± 5 aa |
| Standard deviation of domain lengths | 5.34 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 39.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0045 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W2ARZ5 | 2-53 | KKYRCIPCGYIYDPALGDPDSGIAPDTSFEDLPDNWQCPICFVGKDDFEPIE |
| A0A285F259 | 13-68 | EITMAKYECTVCGYVYNPEEGDPDSGIAPGTAFEDIPDDWECPLCGVSKDMFEKIE |
| A0A7Y9YGZ1 | 418-473 | None |
| A0A661FAB1 | 1-56 | None |
| A0A521RK66 | 805-863 | None |
| A0A1E7FX74 | 21-86 | None |
| A0A849MGX1 | 2-58 | None |
| A0A5C9EC08 | 5-50 | None |
| A0A6L6YGP7 | 16-74 | None |
| A0A7X4JCH9 | 1-43 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.