DPCstruct | MC62047
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 128 ± 12 aa |
| Standard deviation of domain lengths | 12.11 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 18.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y3YNU6 | 69-186 | RRFAVFHVTEGGSSTYFLAEEHLEFLQTASRLRSYIRKAEGDPPARFTGMFPRGEKLSREQFDTYVLERLDNTGRVVGAYHIDLDSE… |
| R9M040 | 115-225 | LSPLALCVVTEGGHSRCFHTLHFGTFAPDTALRSARQYAHDRQISVTDALLSLTTDMVLDANGGAKKILVGGDPDMTQALSAVFSRC… |
| A0A1Y4REM0 | 259-388 | None |
| A0A1Y3W5F6 | 2-143 | None |
| R9M5K5 | 132-271 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.