DPCstruct | MC62044
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 281 ± 65 aa |
| Standard deviation of domain lengths | 65.44 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 88.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 15.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z3CN45 | 6-257 | RLYFYVDESGHTGPNLFDESQPILYYGVLSSKINLDTAAESRVKEIRKKLGVKRLHAAELGNGKLVEIVKDIDVIRKRYDLRFDIYR… |
| D6D2I2 | 5-339 | EVSNSIRMMMKAQGIDEMYIDKEETLYYDESGNVKHLIVKDCKLNADSDTVFVLGGVQADDIISLEELKTALGKNLEKEIKSTKDLK… |
| A0A7Y7Z024 | 3-294 | None |
| A0A4V0ER51 | 4-368 | None |
| A0A3A8Z337 | 4-271 | None |
| A0A1L5LKE3 | 3-362 | None |
| A0A416B244 | 5-218 | None |
| A0A5C0SLJ6 | 35-418 | None |
| A0A011WN45 | 65-441 | None |
| A0A5C5Z1T6 | 1-295 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.