DPCstruct | MC62042
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 69 ± 11 aa |
| Standard deviation of domain lengths | 10.52 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 48.29 |
| Pfam Score | 71.43 |
| Assigned Pfam label(s) | CL0337- PF03462 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y8HNR6 | 9-73 | AQSRKAQVGTGERSEKIRTYNFPQNRVTDHRVGVTLHKLEQVLEGDLDELIQALKAQRQQEVGAA |
| A0A7C1WQG8 | 1-56 | TGDRSDKIRTYNFPQNRVTDHRIGLTLYNLSSIMEGNLDGLIEQLKLADRAEKLQI |
| A0A7S2C505 | 132-213 | None |
| A0A7E4S0E5 | 464-531 | None |
| A0A7V1H8U9 | 20-90 | None |
| A0A0E9SXD3 | 26-90 | None |
| A0A4R9E321 | 405-477 | None |
| A0A1G2SAC6 | 3-76 | None |
| A0A7X7N612 | 1-48 | None |
| A0A7W0TGX0 | 4-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.