DPCstruct | MC6204
Metacluster Properties and Pfam Annotations
| Number of structural domains | 86 |
|---|---|
| Mean domain length (aa) | 77 ± 14 aa |
| Standard deviation of domain lengths | 13.53 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05154 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A268I309 | 1-66 | MKNKIVAGVLGILLGNLGIHKFYLGQIGMGILYVVFCWTGIPGIIGLIEGVIYLVKSDEDFNAKYN |
| A0A1C0A9P3 | 91-164 | PSPHKTLIPLKSKVIAALLAIFLGTFGIHKFYLDKTGQGIVYLLLCWTGIPTMIGLIEGLVYLSTNDYIFAAKY |
| C7N1T3 | 244-336 | None |
| C7N1D1 | 176-265 | None |
| A0A1M7NER4 | 66-139 | None |
| A0A369LLJ5 | 210-302 | None |
| A0A538QL26 | 1-72 | None |
| A0A068MYV6 | 1-72 | None |
| A0A2G6LRI5 | 4-74 | None |
| A0A517WBF2 | 47-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.