DPCstruct | MC62038
Metacluster Properties and Pfam Annotations
| Number of structural domains | 86 |
|---|---|
| Mean domain length (aa) | 219 ± 28 aa |
| Standard deviation of domain lengths | 27.58 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 18.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T0R3U7 | 213-459 | EVEINTDLYEVPIRENHDYITVGEHRIFLLPICEEGRKREIEFKEKIGLALKLIGDSNPGLLDTFMSFTHSIVPVNEPGIVSFSMQS… |
| A0A515D5Z8 | 57-298 | VSKIDIGNWSFNWTNEDAGQAMALLMGITDVGSIPVCDKRLVFLNDGVKRFSSLYESEMAFISDFISTLVWLIPKNENANNGSASFY… |
| A0A4R6M5S9 | 113-322 | None |
| A0A2V8SAH8 | 350-556 | None |
| A0A370W2M5 | 445-682 | None |
| A0A7W6TSJ3 | 87-307 | None |
| A0A3C1DNI5 | 94-306 | None |
| A0A7Y6TWZ8 | 39-265 | None |
| L1KYN1 | 164-402 | None |
| A0A1F9VCT4 | 204-438 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.