DPCstruct | MC62035
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 128 ± 12 aa |
| Standard deviation of domain lengths | 12.29 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 42.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A824BI23 | 1-117 | MRTILFGNSYGGYLANLCAKIAPWSIDFILDNSSFVNLFGNIFRLIGFGKEIDFTRYHGTYDDTLFKNIFLYLSDKTYWNNNKFSKN… |
| A0A7I9LTP5 | 167-299 | MAALDHINALKDLVKCFPKFADLPKIYGGGSYGGYLALLIAKIAPWYVDGVIDNSGSALPPLNYILGREMEHSYGDYYEDFPHNRII… |
| A0A508ZJL0 | 1-132 | None |
| A0A698BXR6 | 1-103 | None |
| A0A7U8G453 | 53-194 | None |
| A0A2N2CB25 | 154-288 | None |
| A0A825QTB6 | 77-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.