DPCstruct | MC62034
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 67 ± 7 aa |
| Standard deviation of domain lengths | 6.63 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 94.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 63.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A824AE00 | 1-62 | MLNTYNDKYLLYPVLYFYGFGNGILFKALLQNKNHQHIVVFEKDIEIIWIMFHILDFSNELQ |
| A0A825ISU4 | 62-127 | LTLFKTEYNKYPVLFFYGFGNGMFYKTLCKNKQHKHIIIFEDNLEILTLAFHLFDFSEELKKEQLI |
| A0A6W1LJ81 | 1-69 | None |
| A0A5T1L4A7 | 72-128 | None |
| A0A824CPS6 | 2-80 | None |
| A0A824KMH1 | 1-67 | None |
| A0A824GGS7 | 1-69 | None |
| A0A7U7VI08 | 68-136 | None |
| A0A824YVX8 | 1-55 | None |
| A0A824WZM3 | 2-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.