DPCstruct | MC6203
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 66 ± 6 aa |
| Standard deviation of domain lengths | 5.75 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 50.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5TUX9 | 84-152 | MRALGVRDGAKLVGALGPCGRGLCCVTFMTRFHSVTVRMAKRQNLSLNPAKISGMCGRLMCCLSHEVEQ |
| A0A2H6IFQ7 | 13-76 | IGGIGVCGREFCCRSFLTSFAPISIRMAKEQELVLNAAKLSGVCGRLMCCLSYEYDEWQADEID |
| A0A2M7ALL3 | 88-147 | None |
| A0A0G0ERH4 | 78-142 | None |
| A0A7V3BRP5 | 101-159 | None |
| A0A349BQU8 | 64-130 | None |
| A0A2N2FRW4 | 71-133 | None |
| A0A2G6EBW4 | 197-263 | None |
| A0A3E2DAV1 | 117-195 | None |
| A0A0U9HXQ9 | 151-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.