DPCstruct | MC62027
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 187 ± 32 aa |
| Standard deviation of domain lengths | 31.63 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 17.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06810 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D9CF72 | 29-222 | APSERMFTQEEVNAMIAKRADKMAKQKFGDIDVSEYQELKAAKEKSQRDELIRKNKFEEVLKQQKEQYDSEVNSLRSQLTSVRVDGA… |
| A0A6S6QXG5 | 1-149 | MKIEQFLKLGLSDEQAKKVMELCKEDKRNFIPKSRFDTLNEKKKKLEMQVMVHKTQLDEMLVANEQNKRLHEQAGQIWEHFISFNRK… |
| A0A413RCV6 | 19-218 | None |
| A0A381ANT5 | 38-259 | None |
| A0A3P3XLJ9 | 16-239 | None |
| A0A1E4LQ76 | 1-150 | None |
| A0A661PML1 | 44-243 | None |
| A0A661PR70 | 39-287 | None |
| A0A1N6DQ72 | 28-191 | None |
| A0A4R9C217 | 1-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.