DPCstruct | MC62023
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 99 ± 21 aa |
| Standard deviation of domain lengths | 20.61 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 80.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 54.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E7AVE3 | 1-72 | MRDKNCERIKLSKTLYDMGMRVAAVSLMCQDYRVWSSMMDAGTPCPIEGQIGDEAKVLWETYPERVPTPERR |
| A0A2D9C3Q2 | 1-117 | MSGAVQTQILGISIGATTRDMNCERLKNAKVLYDMGMKVAAVSVLCMDKRVFESMMNAGTPCPFDGLVGQPAKDAWKNNPHLVPDAK… |
| A0A2D5IEY0 | 59-143 | None |
| A0A2D8ENS0 | 103-216 | None |
| A0A2E7MWX2 | 247-384 | None |
| A0A1Z9UMN9 | 80-166 | None |
| A0A2D7P252 | 1-84 | None |
| A0A836QP09 | 63-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.