DPCstruct | MC6202
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 135 ± 13 aa |
| Standard deviation of domain lengths | 13.03 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 32.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V3DKL1 | 60-204 | EVFLSLRQVLPEVDVTQHPLAGQTGRLEINAPGPDSPVLVTGNAIQTQEVVLAVLSTTSAPFHLLFVDTKGHTVDMAMIYNTLTPEA… |
| A0A2H6IF85 | 104-249 | AEKWKNLALFTLRQNVYTDPQVPMQVEQKIYKIGEATPDSPLLITTNFSLTYFIVSGEVENSKVPAHLAIMDCEGLSVLTAWAAGKF… |
| A0A843CVP9 | 411-537 | None |
| A0A7U9NDB9 | 170-316 | None |
| A0A661VKJ2 | 15-144 | None |
| A0A0F9IC81 | 5-124 | None |
| F8C3P6 | 304-447 | None |
| A0A5K8ADA5 | 298-452 | None |
| A0A352PPZ5 | 3-108 | None |
| A0A662TYG5 | 324-468 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.