DPCstruct | MC62019
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 101 ± 13 aa |
| Standard deviation of domain lengths | 12.68 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 53.07 |
| Pfam Score | 96.43 |
| Assigned Pfam label(s) | CL0020- CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6F9A994 | 8-99 | KRSRERKRRIDGDRQIEVRHRWCELVVKHKYAQAYGDVEHFLIHDQAMGVYLYGELMVQEDSRQQALARRCLSLVQNEMDQSARRVV… |
| A0A4D9FCA2 | 38-128 | LQCLEKTYHLDEQDAEVRHRWCELVVKHKYTTRYADIEKFLKEDQAMGVYLYGELMVNEDAKQQELAYKCFAATQKQMDVSSAKVVA… |
| A0A670Z312 | 218-327 | None |
| H3A9Q3 | 51-162 | None |
| L5K846 | 30-151 | None |
| A0A7F8R8B4 | 93-198 | None |
| A0A7M5WKU3 | 1025-1114 | None |
| A0A5C6N0R4 | 115-215 | None |
| R0LRG2 | 292-379 | None |
| A0A7M7T3N7 | 444-556 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.