DPCstruct | MC62014
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 275 ± 48 aa |
| Standard deviation of domain lengths | 48.28 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 33.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09738 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6F8ZMU7 | 2-247 | EEQMAEMRRETEDKSKELERQKHTCTVLQHKQVELKEGIRQRDELIEKHGLVIIPEGMPNGDISHTDPATGITVVTQEAAQVLESAG… |
| A0A5E4MQI2 | 70-354 | NFRDFRMELKDLEEKFRKSMVQNAQLDNEKAAITYLIELYKDKYTDIEEELIHIKREYKESTRENDKLKRLLATQKLECLTLRHELQ… |
| A0A0K0DVX9 | 108-384 | None |
| T1KNC6 | 25-335 | None |
| A0A484ASS0 | 2-200 | None |
| M7BJT1 | 118-424 | None |
| A0A3M7S9Y8 | 121-429 | None |
| A0A7J7J4I0 | 5-291 | None |
| A0A443SP72 | 5-287 | None |
| A0A0V0JAE3 | 2-318 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.