DPCstruct | MC62013
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 81 ± 11 aa |
| Standard deviation of domain lengths | 10.74 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 42.60 |
| Pfam Score | 80.00 |
| Assigned Pfam label(s) | CL0125- CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6F8ZKZ1 | 4-83 | MAGRLARQQERDNGAGTNQQAVKYLQQDHETLLQDCLETGSLFQDPSFPAESKSLGYKELGKYSAKTKGLMWKRPTVRDH |
| A0A3B4WZW4 | 4-67 | RLFQANAIPFNQQDFEQLRSECLQSGSLFCDPTFPATWDSLGYNQLGRYSSKTIGVEWKRPTVS |
| A0A836CV14 | 12-88 | None |
| A0A673HST5 | 5-50 | None |
| A0A498MZB5 | 1-79 | None |
| A0A643BR65 | 1-80 | None |
| A0A3N0Z190 | 17-89 | None |
| A0A0A0MQJ1 | 51-143 | None |
| A0A5F4WLX7 | 1-73 | None |
| V8N6M4 | 4-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.